AGER MaxPab mouse polyclonal antibody (B01P)
  • AGER MaxPab mouse polyclonal antibody (B01P)

AGER MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00000177-B01P
AGER MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AGER protein.
Información adicional
Size 50 ug
Gene Name AGER
Gene Alias MGC22357|RAGE
Gene Description advanced glycosylation end product-specific receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AGER (NP_001127, 1 a.a. ~ 404 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 177

Enviar un mensaje


AGER MaxPab mouse polyclonal antibody (B01P)

AGER MaxPab mouse polyclonal antibody (B01P)