AFP monoclonal antibody (M04), clone 1A24
  • AFP monoclonal antibody (M04), clone 1A24

AFP monoclonal antibody (M04), clone 1A24

Ref: AB-H00000174-M04
AFP monoclonal antibody (M04), clone 1A24

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AFP.
Información adicional
Size 100 ug
Gene Name AFP
Gene Alias FETA|HPAFP
Gene Description alpha-fetoprotein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AFP (AAH27881, 500 a.a. ~ 609 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 174
Clone Number 1A24
Iso type IgG2b Kappa

Enviar un mensaje


AFP monoclonal antibody (M04), clone 1A24

AFP monoclonal antibody (M04), clone 1A24