ADSL purified MaxPab rabbit polyclonal antibody (D01P)
  • ADSL purified MaxPab rabbit polyclonal antibody (D01P)

ADSL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000158-D01P
ADSL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ADSL protein.
Información adicional
Size 100 ug
Gene Name ADSL
Gene Alias AMPS|ASASE|ASL
Gene Description adenylosuccinate lyase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ADSL (NP_000017.1, 1 a.a. ~ 484 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 158

Enviar un mensaje


ADSL purified MaxPab rabbit polyclonal antibody (D01P)

ADSL purified MaxPab rabbit polyclonal antibody (D01P)