ADRB2 purified MaxPab rabbit polyclonal antibody (D01P)
  • ADRB2 purified MaxPab rabbit polyclonal antibody (D01P)

ADRB2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000154-D01P
ADRB2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ADRB2 protein.
Información adicional
Size 100 ug
Gene Name ADRB2
Gene Alias ADRB2R|ADRBR|B2AR|BAR|BETA2AR
Gene Description adrenergic, beta-2-, receptor, surface
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MGQPGNGSAFLLAPNRSHAPDHDVTQQRDEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINCYANETCCDFFTNQAYAIASSIVSFYVPLVIMVFVYSRVFQEAKRQLQKIDKSEGRFHVQNLSQVEQDGRTG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ADRB2 (NP_000015.1, 1 a.a. ~ 413 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 154

Enviar un mensaje


ADRB2 purified MaxPab rabbit polyclonal antibody (D01P)

ADRB2 purified MaxPab rabbit polyclonal antibody (D01P)