ADORA2A purified MaxPab rabbit polyclonal antibody (D01P)
  • ADORA2A purified MaxPab rabbit polyclonal antibody (D01P)

ADORA2A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000135-D01P
ADORA2A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ADORA2A protein.
Información adicional
Size 100 ug
Gene Name ADORA2A
Gene Alias ADORA2|RDC8|hA2aR
Gene Description adenosine A2a receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ADORA2A (NP_000666.2, 1 a.a. ~ 412 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 135

Enviar un mensaje


ADORA2A purified MaxPab rabbit polyclonal antibody (D01P)

ADORA2A purified MaxPab rabbit polyclonal antibody (D01P)