Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ADORA2A purified MaxPab mouse polyclonal antibody (B02P)
Abnova
ADORA2A purified MaxPab mouse polyclonal antibody (B02P)
Ref: AB-H00000135-B02P
ADORA2A purified MaxPab mouse polyclonal antibody (B02P)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a full-length human ADORA2A protein.
Información adicional
Size
50 ug
Gene Name
ADORA2A
Gene Alias
ADORA2|RDC8|hA2aR
Gene Description
adenosine A2a receptor
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCF
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ADORA2A (NP_000666, 1 a.a. ~ 412 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
135
Enviar un mensaje
ADORA2A purified MaxPab mouse polyclonal antibody (B02P)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*