Ver mas grande
ACYP1 monoclonal antibody (M01), clone S3
AB-H00000097-M01
Producto nuevo
ACYP1 monoclonal antibody (M01), clone S3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | ACYP1 |
| Gene Alias | ACYPE |
| Gene Description | acylphosphatase 1, erythrocyte (common) type |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ACYP1 (AAH35568, 1 a.a. ~ 99 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 97 |
| Clone Number | S3 |
| Iso type | IgG2b kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant ACYP1.