ACYP1 monoclonal antibody (M01), clone S3
  • ACYP1 monoclonal antibody (M01), clone S3

ACYP1 monoclonal antibody (M01), clone S3

Ref: AB-H00000097-M01
ACYP1 monoclonal antibody (M01), clone S3

Información del producto

Mouse monoclonal antibody raised against a full length recombinant ACYP1.
Información adicional
Size 100 ug
Gene Name ACYP1
Gene Alias ACYPE
Gene Description acylphosphatase 1, erythrocyte (common) type
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACYP1 (AAH35568, 1 a.a. ~ 99 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 97
Clone Number S3
Iso type IgG2b kappa

Enviar un mensaje


ACYP1 monoclonal antibody (M01), clone S3

ACYP1 monoclonal antibody (M01), clone S3