Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ACVRL1 monoclonal antibody (M05), clone 5F2
Abnova
ACVRL1 monoclonal antibody (M05), clone 5F2
Ref: AB-H00000094-M05
ACVRL1 monoclonal antibody (M05), clone 5F2
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ACVRL1.
Información adicional
Size
100 ug
Gene Name
ACVRL1
Gene Alias
ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
Gene Description
activin A receptor type II-like 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
94
Clone Number
5F2
Iso type
IgG1 Kappa
Enviar un mensaje
ACVRL1 monoclonal antibody (M05), clone 5F2
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*