ACVRL1 monoclonal antibody (M01), clone 5B1
  • ACVRL1 monoclonal antibody (M01), clone 5B1

ACVRL1 monoclonal antibody (M01), clone 5B1

Ref: AB-H00000094-M01
ACVRL1 monoclonal antibody (M01), clone 5B1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ACVRL1.
Información adicional
Size 100 ug
Gene Name ACVRL1
Gene Alias ACVRLK1|ALK-1|ALK1|HHT|HHT2|ORW2|SKR3|TSR-I
Gene Description activin A receptor type II-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACVRL1 (AAH42637, 22 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 94
Clone Number 5B1
Iso type IgG1 Kappa

Enviar un mensaje


ACVRL1 monoclonal antibody (M01), clone 5B1

ACVRL1 monoclonal antibody (M01), clone 5B1