Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ACVR1B monoclonal antibody (M06), clone 2E12
Abnova
ACVR1B monoclonal antibody (M06), clone 2E12
Ref: AB-H00000091-M06
ACVR1B monoclonal antibody (M06), clone 2E12
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ACVR1B.
Información adicional
Size
100 ug
Gene Name
ACVR1B
Gene Alias
ACTRIB|ACVRLK4|ALK4|SKR2
Gene Description
activin A receptor, type IB
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ACVR1B (AAH00254, 24 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
91
Clone Number
2E12
Iso type
IgG1 Kappa
Enviar un mensaje
ACVR1B monoclonal antibody (M06), clone 2E12
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*