ACTN4 polyclonal antibody (A01)
  • ACTN4 polyclonal antibody (A01)

ACTN4 polyclonal antibody (A01)

Ref: AB-H00000081-A01
ACTN4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ACTN4.
Información adicional
Size 50 uL
Gene Name ACTN4
Gene Alias ACTININ-4|DKFZp686K23158|FSGS|FSGS1
Gene Description actinin, alpha 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq KEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACTN4 (NP_004915, 592 a.a. ~ 701 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 81

Enviar un mensaje


ACTN4 polyclonal antibody (A01)

ACTN4 polyclonal antibody (A01)