ACPP monoclonal antibody (M01), clone 2D11
  • ACPP monoclonal antibody (M01), clone 2D11

ACPP monoclonal antibody (M01), clone 2D11

Ref: AB-H00000055-M01
100 ug

Información del producto

ACPP monoclonal antibody (M01), clone 2D11
Información adicional
Size 100 ug
Gene Name ACPP
Gene Alias ACP-3|ACP3|PAP
Gene Description acid phosphatase, prostate
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq YASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELAGPVIPQDWSTECMTTNSHQVLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACPP (AAH07460, 310 a.a. ~ 418 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55
Clone Number 2D11
Iso type IgG2b Kappa

Enviar un mensaje


ACPP monoclonal antibody (M01), clone 2D11

ACPP monoclonal antibody (M01), clone 2D11