ACPP polyclonal antibody (A01)
  • ACPP polyclonal antibody (A01)

ACPP polyclonal antibody (A01)

Ref: AB-H00000055-A01
50 uL

Información del producto

ACPP polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name ACPP
Gene Alias ACP-3|ACP3|PAP
Gene Description acid phosphatase, prostate
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq YASCHLTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELAGPVIPQDWSTECMTTNSHQVLKVIFAVAFCLISAVLMVLLFIHIRRGLCWQRESYGNI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACPP (AAH07460, 310 a.a. ~ 418 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55

Enviar un mensaje


ACPP polyclonal antibody (A01)

ACPP polyclonal antibody (A01)