ACP5 monoclonal antibody (M01), clone 2D9
  • ACP5 monoclonal antibody (M01), clone 2D9

ACP5 monoclonal antibody (M01), clone 2D9

Ref: AB-H00000054-M01
ACP5 monoclonal antibody (M01), clone 2D9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ACP5.
Información adicional
Size 100 ug
Gene Name ACP5
Gene Alias MGC117378|TRAP
Gene Description acid phosphatase 5, tartrate resistant
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACP5 (AAH25414.1, 72 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 54
Clone Number 2D9
Iso type IgG2a Kappa

Enviar un mensaje


ACP5 monoclonal antibody (M01), clone 2D9

ACP5 monoclonal antibody (M01), clone 2D9