ACP5 polyclonal antibody (A01)
  • ACP5 polyclonal antibody (A01)

ACP5 polyclonal antibody (A01)

Ref: AB-H00000054-A01
50 uL

Información del producto

ACP5 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name ACP5
Gene Alias MGC117378|TRAP
Gene Description acid phosphatase 5, tartrate resistant
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VKQLRPLLATYGVTAYLCGHDHNLQYLQDENGVGYVLSGAGNFMDPSKRHQRKVPNGYLRFHYGTEDSLGGFAYVEISSKEMTVTYIEASGKSLFKTRLPRRARP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACP5 (NP_001602, 221 a.a. ~ 325 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 54

Enviar un mensaje


ACP5 polyclonal antibody (A01)

ACP5 polyclonal antibody (A01)