ACP1 monoclonal antibody (M10), clone 2A15
  • ACP1 monoclonal antibody (M10), clone 2A15

ACP1 monoclonal antibody (M10), clone 2A15

Ref: AB-H00000052-M10
100 ug

Información del producto

ACP1 monoclonal antibody (M10), clone 2A15
Información adicional
Size 100 ug
Gene Name ACP1
Gene Alias HAAP|MGC111030|MGC3499
Gene Description acid phosphatase 1, soluble
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACP1 (AAH07422, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 52
Clone Number 2A15
Iso type IgG2a Kappa

Enviar un mensaje


ACP1 monoclonal antibody (M10), clone 2A15

ACP1 monoclonal antibody (M10), clone 2A15