ACP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ACP1 purified MaxPab rabbit polyclonal antibody (D01P)

ACP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000052-D01P
ACP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ACP1 protein.
Información adicional
Size 100 ug
Gene Name ACP1
Gene Alias HAAP|MGC111030|MGC3499
Gene Description acid phosphatase 1, soluble
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACP1 (NP_009030.1, 1 a.a. ~ 158 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 52

Enviar un mensaje


ACP1 purified MaxPab rabbit polyclonal antibody (D01P)

ACP1 purified MaxPab rabbit polyclonal antibody (D01P)