ACO2 monoclonal antibody (M01), clone 1A11
  • ACO2 monoclonal antibody (M01), clone 1A11

ACO2 monoclonal antibody (M01), clone 1A11

Ref: AB-H00000050-M01
100 ug

Información del producto

ACO2 monoclonal antibody (M01), clone 1A11
Información adicional
Size 100 ug
Gene Name ACO2
Gene Alias ACONM|MGC20605|MGC33908
Gene Description aconitase 2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACO2 (AAH14092, 1 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50
Clone Number 1A11
Iso type IgG2a Kappa

Enviar un mensaje


ACO2 monoclonal antibody (M01), clone 1A11

ACO2 monoclonal antibody (M01), clone 1A11