ACO2 purified MaxPab rabbit polyclonal antibody (D01P)
  • ACO2 purified MaxPab rabbit polyclonal antibody (D01P)

ACO2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000050-D01P
100 ug

Información del producto

ACO2 purified MaxPab rabbit polyclonal antibody (D01P)
Información adicional
Size 100 ug
Gene Name ACO2
Gene Alias ACONM|MGC20605|MGC33908
Gene Description aconitase 2, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACO2 (NP_001089.1, 1 a.a. ~ 780 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50

Enviar un mensaje


ACO2 purified MaxPab rabbit polyclonal antibody (D01P)

ACO2 purified MaxPab rabbit polyclonal antibody (D01P)