ACADS polyclonal antibody (A01)
  • ACADS polyclonal antibody (A01)

ACADS polyclonal antibody (A01)

Ref: AB-H00000035-A01
50 uL

Información del producto

ACADS polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name ACADS
Gene Alias ACAD3|SCAD
Gene Description acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEASAAVVFASTDRALQNKGISAFLVPMPTPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACADS (NP_000008, 132 a.a. ~ 221 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 35

Enviar un mensaje


ACADS polyclonal antibody (A01)

ACADS polyclonal antibody (A01)