ACADM monoclonal antibody (M04), clone 3A2
  • ACADM monoclonal antibody (M04), clone 3A2

ACADM monoclonal antibody (M04), clone 3A2

Ref: AB-H00000034-M04
100 ug

Información del producto

ACADM monoclonal antibody (M04), clone 3A2
Información adicional
Size 100 ug
Gene Name ACADM
Gene Alias ACAD1|FLJ18227|FLJ93013|FLJ99884|MCAD|MCADH
Gene Description acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACADM (NP_000007, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 34
Clone Number 3A2
Iso type IgG2b Kappa

Enviar un mensaje


ACADM monoclonal antibody (M04), clone 3A2

ACADM monoclonal antibody (M04), clone 3A2