Ver mas grande
ACADM monoclonal antibody (M04), clone 3A2
AB-H00000034-M04
Producto nuevo
ACADM monoclonal antibody (M04), clone 3A2
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | ACADM |
| Gene Alias | ACAD1|FLJ18227|FLJ93013|FLJ99884|MCAD|MCADH |
| Gene Description | acyl-Coenzyme A dehydrogenase, C-4 to C-12 straight chain |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA |
| Immunogen Prot. Seq | MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ACADM (NP_000007, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 34 |
| Clone Number | 3A2 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant ACADM.