ACADL polyclonal antibody (A01)
  • ACADL polyclonal antibody (A01)

ACADL polyclonal antibody (A01)

Ref: AB-H00000033-A01
50 uL

Información del producto

ACADL polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name ACADL
Gene Alias ACAD4|FLJ94052|LCAD
Gene Description acyl-Coenzyme A dehydrogenase, long chain
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAARLLRGSLRVLGGHRAPRQLPAARCSHSGGEERLETPSAKKLTDIGIRRIFSPEHDIFRKSVRKFFQEEVIPHHSEWEKAGEVSREVWEKAGKQGLLGVNIAEHLGGIGGDLYSAAIVWEEQAYSNCSGPGFSIHSGIVMSYITNHGSEEQIKHFIPQMTAGKCIGAIAMTEPGAGSDLQGIKTNAKKDGSDWILNGSKVFISNGSLSDVVIVVAVTNHEAPSPAHGISLFLVENGMKGFIKGRKLHKMGLKA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACADL (AAH39063, 1 a.a. ~ 430 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 33

Enviar un mensaje


ACADL polyclonal antibody (A01)

ACADL polyclonal antibody (A01)