ACACB monoclonal antibody (M02A), clone 3E8
  • ACACB monoclonal antibody (M02A), clone 3E8

ACACB monoclonal antibody (M02A), clone 3E8

Ref: AB-H00000032-M02A
200 uL

Información del producto

ACACB monoclonal antibody (M02A), clone 3E8
Información adicional
Size 200 uL
Gene Name ACACB
Gene Alias ACC2|ACCB|HACC275
Gene Description acetyl-Coenzyme A carboxylase beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACACB (NP_001084, 22 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 32
Clone Number 3E8
Iso type IgM Kappa

Enviar un mensaje


ACACB monoclonal antibody (M02A), clone 3E8

ACACB monoclonal antibody (M02A), clone 3E8