ABL2 monoclonal antibody (M09), clone 5C6
  • ABL2 monoclonal antibody (M09), clone 5C6

ABL2 monoclonal antibody (M09), clone 5C6

Ref: AB-H00000027-M09
ABL2 monoclonal antibody (M09), clone 5C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ABL2.
Información adicional
Size 100 ug
Gene Name ABL2
Gene Alias ABLL|ARG|FLJ22224|FLJ31718|FLJ41441
Gene Description v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq KKTLGLRAGKPTASDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEESAAPSRERPKAKLLPRGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ABL2 (AAH65912, 743 a.a. ~ 842 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27
Clone Number 5C6
Iso type IgG3 Kappa

Enviar un mensaje


ABL2 monoclonal antibody (M09), clone 5C6

ABL2 monoclonal antibody (M09), clone 5C6