ABCF1 monoclonal antibody (M01), clone 1B4
  • ABCF1 monoclonal antibody (M01), clone 1B4

ABCF1 monoclonal antibody (M01), clone 1B4

Ref: AB-H00000023-M01
100 ug

Información del producto

ABCF1 monoclonal antibody (M01), clone 1B4
Información adicional
Size 100 ug
Gene Name ABCF1
Gene Alias ABC27|ABC50
Gene Description ATP-binding cassette, sub-family F (GCN20), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA,IF
Immunogen Prot. Seq GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ABCF1 (NP_001081, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23
Clone Number 1B4
Iso type IgG2a Kappa

Enviar un mensaje


ABCF1 monoclonal antibody (M01), clone 1B4

ABCF1 monoclonal antibody (M01), clone 1B4