ABCF1 polyclonal antibody (A01)
  • ABCF1 polyclonal antibody (A01)

ABCF1 polyclonal antibody (A01)

Ref: AB-H00000023-A01
50 uL

Información del producto

ABCF1 polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name ABCF1
Gene Alias ABC27|ABC50
Gene Description ATP-binding cassette, sub-family F (GCN20), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNLPYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ABCF1 (NP_001081, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23

Enviar un mensaje


ABCF1 polyclonal antibody (A01)

ABCF1 polyclonal antibody (A01)