ABCA1 monoclonal antibody (M01A), clone 1H4
  • ABCA1 monoclonal antibody (M01A), clone 1H4

ABCA1 monoclonal antibody (M01A), clone 1H4

Ref: AB-H00000019-M01A
ABCA1 monoclonal antibody (M01A), clone 1H4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ABCA1.
Información adicional
Size 200 uL
Gene Name ABCA1
Gene Alias ABC-1|ABC1|CERP|FLJ14958|HDLDT1|MGC164864|MGC165011|TGD
Gene Description ATP-binding cassette, sub-family A (ABC1), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq TPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ABCA1 (NP_005493, 86 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 19
Clone Number 1H4
Iso type IgM Kappa

Enviar un mensaje


ABCA1 monoclonal antibody (M01A), clone 1H4

ABCA1 monoclonal antibody (M01A), clone 1H4