AAMP monoclonal antibody (M02), clone 2H2
  • AAMP monoclonal antibody (M02), clone 2H2

AAMP monoclonal antibody (M02), clone 2H2

Ref: AB-H00000014-M02
100 ug

Información del producto

AAMP monoclonal antibody (M02), clone 2H2
Información adicional
Size 100 ug
Gene Name AAMP
Gene Alias -
Gene Description angio-associated, migratory cell protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AAMP (NP_001078.2, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 14
Clone Number 2H2
Iso type IgG2b Kappa

Enviar un mensaje


AAMP monoclonal antibody (M02), clone 2H2

AAMP monoclonal antibody (M02), clone 2H2