AADAC polyclonal antibody (A01)
  • AADAC polyclonal antibody (A01)

AADAC polyclonal antibody (A01)

Ref: AB-H00000013-A01
50 uL

Información del producto

AADAC polyclonal antibody (A01)
Información adicional
Size 50 uL
Gene Name AADAC
Gene Alias CES5A1|DAC
Gene Description arylacetamide deacetylase (esterase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq QLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFINWSSLLPERFIKGHVYNNP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AADAC (NP_001077, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 13

Enviar un mensaje


AADAC polyclonal antibody (A01)

AADAC polyclonal antibody (A01)