NAT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • NAT1 purified MaxPab rabbit polyclonal antibody (D01P)

NAT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00000009-D01P
NAT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NAT1 protein.
Información adicional
Size 100 ug
Gene Name NAT1
Gene Alias AAC1|NATI
Gene Description N-acetyltransferase 1 (arylamine N-acetyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NAT1 (NP_000653.3, 1 a.a. ~ 290 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9

Enviar un mensaje


NAT1 purified MaxPab rabbit polyclonal antibody (D01P)

NAT1 purified MaxPab rabbit polyclonal antibody (D01P)