NAT1 polyclonal antibody (A01)
  • NAT1 polyclonal antibody (A01)

NAT1 polyclonal antibody (A01)

Ref: AB-H00000009-A01
NAT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NAT1.
Información adicional
Size 50 uL
Gene Name NAT1
Gene Alias AAC1|NATI
Gene Description N-acetyltransferase 1 (arylamine N-acetyltransferase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NAT1 (NP_000653, 201 a.a. ~ 290 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9

Enviar un mensaje


NAT1 polyclonal antibody (A01)

NAT1 polyclonal antibody (A01)