FGF1 (Human) Recombinant Protein View larger

Human FGF1 recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8587

New product

FGF1 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 ug
Gene Name FGF1
Gene Alias AFGF|ECGF|ECGF-beta|ECGFA|ECGFB|FGF-alpha|FGFA|GLIO703|HBGF1
Gene Description fibroblast growth factor 1 (acidic)
Storage Conditions Stored at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq AEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.4 (0.5 mM DTT, 2 mM EDTA, 5 % Trehalose). Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 2246

More info

Human FGF1 recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human FGF1 recombinant protein expressed in <i>Escherichia coli</i>.

Human FGF1 recombinant protein expressed in <i>Escherichia coli</i>.