IDH1 monoclonal antibody, clone CL0219 Ver mas grande

IDH1 monoclonal antibody, clone CL0219

AB-MAB15566

Producto nuevo

IDH1 monoclonal antibody, clone CL0219

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 100 uL
Gene Name IDH1
Gene Alias IDCD|IDH|IDP|IDPC|PICD
Gene Description isocitrate dehydrogenase 1 (NADP+), soluble
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)<br>Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)<br>Western Blot (1:500-1:1000)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IDH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3417
Clone Number CL0219
Iso type IgG2a

Más información

Mouse monoclonal antibody raised against partial recombinant human IDH1.

Consulta sobre un producto

IDH1 monoclonal antibody, clone CL0219

IDH1 monoclonal antibody, clone CL0219