IDH1 monoclonal antibody, clone CL0219 View larger

Mouse monoclonal antibody raised against partial recombinant human IDH1.

AB-MAB15566

New product

IDH1 monoclonal antibody, clone CL0219

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 100 uL
Gene Name IDH1
Gene Alias IDCD|IDH|IDP|IDPC|PICD
Gene Description isocitrate dehydrogenase 1 (NADP+), soluble
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)<br>Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:5000-1:10000)<br>Western Blot (1:500-1:1000)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IDH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3417
Clone Number CL0219
Iso type IgG2a

More info

Mouse monoclonal antibody raised against partial recombinant human IDH1.

Enviar uma mensagem

Mouse monoclonal antibody raised against partial recombinant human IDH1.

Mouse monoclonal antibody raised against partial recombinant human IDH1.