Ver mas grande
DDIT4L MaxPab rabbit polyclonal antibody (D01)
AB-H00115265-D01
Producto nuevo
DDIT4L MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | DDIT4L |
| Gene Alias | REDD2|Rtp801L |
| Gene Description | DNA-damage-inducible transcript 4-like |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | DDIT4L (NP_660287.1, 1 a.a. ~ 193 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 115265 |
Más información
Rabbit polyclonal antibody raised against a full-length human DDIT4L protein.