View larger
Rabbit polyclonal antibody raised against a full-length human DDIT4L protein.
AB-H00115265-D01
New product
DDIT4L MaxPab rabbit polyclonal antibody (D01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | DDIT4L |
| Gene Alias | REDD2|Rtp801L |
| Gene Description | DNA-damage-inducible transcript 4-like |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IP |
| Immunogen Prot. Seq | MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | DDIT4L (NP_660287.1, 1 a.a. ~ 193 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 115265 |
More info
Rabbit polyclonal antibody raised against a full-length human DDIT4L protein.