Ver mas grande
SLC25A25 monoclonal antibody (M02), clone 4D8
AB-H00114789-M02
Producto nuevo
SLC25A25 monoclonal antibody (M02), clone 4D8
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | SLC25A25 |
| Gene Alias | KIAA1896|MCSC|MGC105138|MGC119514|MGC119515|MGC119516|MGC119517|PCSCL|RP11-395P17.4|SCAMC-2 |
| Gene Description | solute carrier family 25 (mitochondrial carrier |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | LCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC25A25 (NP_443133, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 114789 |
| Clone Number | 4D8 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SLC25A25.