SLC25A25 monoclonal antibody (M02), clone 4D8 View larger

Mouse monoclonal antibody raised against a partial recombinant SLC25A25.

AB-H00114789-M02

New product

SLC25A25 monoclonal antibody (M02), clone 4D8

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name SLC25A25
Gene Alias KIAA1896|MCSC|MGC105138|MGC119514|MGC119515|MGC119516|MGC119517|PCSCL|RP11-395P17.4|SCAMC-2
Gene Description solute carrier family 25 (mitochondrial carrier
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKSLDKKNDGRIDAQEIMQSLRDL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC25A25 (NP_443133, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 114789
Clone Number 4D8
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant SLC25A25.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant SLC25A25.

Mouse monoclonal antibody raised against a partial recombinant SLC25A25.