Ver mas grande
NFATC2IP monoclonal antibody (M01), clone 2D7-A10
AB-H00084901-M01
Producto nuevo
NFATC2IP monoclonal antibody (M01), clone 2D7-A10
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | NFATC2IP |
| Gene Alias | FLJ14639|MGC126790|MGC138387 |
| Gene Description | nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | NFATC2IP (AAH18311, 1 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 84901 |
| Clone Number | 2D7-A10 |
| Iso type | IgG1 kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant NFATC2IP.