NFATC2IP monoclonal antibody (M01), clone 2D7-A10 View larger

Mouse monoclonal antibody raised against a full length recombinant NFATC2IP.

AB-H00084901-M01

New product

NFATC2IP monoclonal antibody (M01), clone 2D7-A10

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name NFATC2IP
Gene Alias FLJ14639|MGC126790|MGC138387
Gene Description nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NFATC2IP (AAH18311, 1 a.a. ~ 138 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 84901
Clone Number 2D7-A10
Iso type IgG1 kappa

More info

Mouse monoclonal antibody raised against a full length recombinant NFATC2IP.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full length recombinant NFATC2IP.

Mouse monoclonal antibody raised against a full length recombinant NFATC2IP.