AB-H00084152-M03
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 100 ug |
Gene Name | PPP1R1B |
Gene Alias | DARPP-32|DARPP32|FLJ20940 |
Gene Description | protein phosphatase 1, regulatory (inhibitor) subunit 1B |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Re,S-ELISA,ELISA |
Immunogen Prot. Seq | MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | PPP1R1B (AAH01519, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 84152 |
Clone Number | 3G11 |
Iso type | IgG2b Kappa |