View larger
Mouse monoclonal antibody raised against a full length recombinant PPP1R1B.
AB-H00084152-M03
New product
PPP1R1B monoclonal antibody (M03), clone 3G11
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PPP1R1B |
| Gene Alias | DARPP-32|DARPP32|FLJ20940 |
| Gene Description | protein phosphatase 1, regulatory (inhibitor) subunit 1B |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PPP1R1B (AAH01519, 1 a.a. ~ 168 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 84152 |
| Clone Number | 3G11 |
| Iso type | IgG2b Kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant PPP1R1B.