RBP5 monoclonal antibody (M05), clone 2D1 Ver mas grande

RBP5 monoclonal antibody (M05), clone 2D1

AB-H00083758-M05

Producto nuevo

RBP5 monoclonal antibody (M05), clone 2D1

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name RBP5
Gene Alias CRBP-III|CRBP3|CRBPIII
Gene Description retinol binding protein 5, cellular
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBP5 (NP_113679.1, 1 a.a. ~ 135 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 83758
Clone Number 2D1
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a full-length recombinant RBP5.

Consulta sobre un producto

RBP5 monoclonal antibody (M05), clone 2D1

RBP5 monoclonal antibody (M05), clone 2D1