RBP5 monoclonal antibody (M05), clone 2D1 View larger

Mouse monoclonal antibody raised against a full-length recombinant RBP5.

AB-H00083758-M05

New product

RBP5 monoclonal antibody (M05), clone 2D1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name RBP5
Gene Alias CRBP-III|CRBP3|CRBPIII
Gene Description retinol binding protein 5, cellular
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RBP5 (NP_113679.1, 1 a.a. ~ 135 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 83758
Clone Number 2D1
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a full-length recombinant RBP5.

Enviar uma mensagem

Mouse monoclonal antibody raised against a full-length recombinant RBP5.

Mouse monoclonal antibody raised against a full-length recombinant RBP5.