Igf1 (Gilthead Seabream) Recombinant Protein
  • Igf1 (Gilthead Seabream) Recombinant Protein

Igf1 (Gilthead Seabream) Recombinant Protein

Ref: AB-P8186
Igf1 (Gilthead Seabream) Recombinant Protein

Información del producto

Gilthead Seabream Igf1 (Q4G1F3, 44 a.a. - 109 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSPETLCGAELVDTLQFVCGERGFYFSKPGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSK
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile 0.4% NaHCO3, pH 8-9 >
Gene ID 115595593

Enviar uma mensagem


Igf1 (Gilthead Seabream) Recombinant Protein

Igf1 (Gilthead Seabream) Recombinant Protein