IRF5 (Human) Recombinant Protein
  • IRF5 (Human) Recombinant Protein

IRF5 (Human) Recombinant Protein

Ref: AB-P8174
IRF5 (Human) Recombinant Protein

Información del producto

Human IRF5 (Q13568, 176 a.a. - 240 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IRF5
Gene Alias SLEB10
Gene Description interferon regulatory factor 5
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLI
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In 20mM Tris-HCl buffer pH 8.0 (0.15M NaCl, 1mM DTT, 30% glycerol)
Gene ID 3663

Enviar uma mensagem


IRF5 (Human) Recombinant Protein

IRF5 (Human) Recombinant Protein