TP1 (Ovine) Recombinant Protein
  • TP1 (Ovine) Recombinant Protein

TP1 (Ovine) Recombinant Protein

Ref: AB-P8170
TP1 (Ovine) Recombinant Protein

Información del producto

Ovine TP1 (P56828, 24 a.a. - 195 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name TP-1
Gene Alias IFNT1|IFNT4|OTP
Gene Description trophoblast protein-1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTTLLEQLCTGLQQQLDHLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTKMGGDLNSP
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 100144750

Enviar uma mensagem


TP1 (Ovine) Recombinant Protein

TP1 (Ovine) Recombinant Protein