IFNG (Feline) Recombinant Protein
  • IFNG (Feline) Recombinant Protein

IFNG (Feline) Recombinant Protein

Ref: AB-P8166
IFNG (Feline) Recombinant Protein

Información del producto

Feline IFNG (P46402, 24 a.a. - 167 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name IFNG
Gene Alias -
Gene Description interferon, gamma
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSQAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWKEESDKTIIQSQIVSFYLKMFENLKDDDQRIQRSMDTIKEDMLDKLLNTSSSKRDDFLKLIQIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK
Form Liquid
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer In PBS pH 7.4 (10% glycerol)
Gene ID 493965

Enviar uma mensagem


IFNG (Feline) Recombinant Protein

IFNG (Feline) Recombinant Protein