IFNG (Horse) Recombinant Protein
  • IFNG (Horse) Recombinant Protein

IFNG (Horse) Recombinant Protein

Ref: AB-P8163
IFNG (Horse) Recombinant Protein

Información del producto

Horse IFNG (P42160, 24 a.a. - 166 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name IFNG
Gene Alias -
Gene Description interferon, gamma
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QAAFFKEIENLKEYFNASNPDVGDGGPLFLDILKNWKEDSDKKIIQSQIVSFYFKLFENLKDNQVIQKSMDTIKEDLFVKFFNSSTSKLEDFQKLIQIPVNDLKVQRKAISELIKVMNDLSPKANLRKRKRSQNPFRGRRALQ
Form Lyophilized
Recomended Dilution Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage Buffer Lyophilized from sterile distilled Water is >
Gene ID 100034181

Enviar uma mensagem


IFNG (Horse) Recombinant Protein

IFNG (Horse) Recombinant Protein