View larger
Mouse Ifng (P01580, 23 a.a. - 155 a.a.) partial recombinant protein with His tag at N-terminus expressed in <i>Escherichia coli<
AB-P8161
New product
Ifng (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | Ifng |
| Gene Alias | IFN-g|IFN-gamma|Ifg |
| Gene Description | interferon gamma |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
| Form | Liquid |
| Recomended Dilution | Biological Activity<br>SDS-PAGE<br>The optimal working dilution should be determined by the end user. |
| Storage Buffer | In 20mM Tris-HCl pH 7.5 (1M DTT, 20% glycerol) |
| Gene ID | 15978 |
More info
Mouse Ifng (P01580, 23 a.a. - 155 a.a.) partial recombinant protein with His tag at N-terminus expressed in Escherichia coli.